PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA31439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 536aa    MW: 59196.2 Da    PI: 6.797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA31439genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-183986148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT  Ed +l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Tp57577_TGAC_v2_mRNA31439 39 KGPWTSAEDAILIDYVRKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 86
                               79******************************************9986 PP

2Myb_DNA-binding51.22.9e-1692135146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g++T+eE++l+++++ ++G++ W++ a++++ gRt++++k++w++
  Tp57577_TGAC_v2_mRNA31439  92 KGSFTAEEEQLIAQLHSEMGNR-WARMAAHLP-GRTDNEIKNYWNT 135
                                799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0733486IPR017930Myb domain
SuperFamilySSF466893.03E-3038133IPR009057Homeodomain-like
SMARTSM007171.2E-153888IPR001005SANT/Myb domain
PfamPF002497.1E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-244093IPR009057Homeodomain-like
CDDcd001677.69E-124186No hitNo description
PROSITE profilePS5129423.44787141IPR017930Myb domain
SMARTSM007173.6E-1691139IPR001005SANT/Myb domain
PfamPF002492.1E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2594140IPR009057Homeodomain-like
CDDcd001675.74E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MKRVKNENEE DVLCNDQTQS RLNGEGNGGS VGGGVVLKKG PWTSAEDAIL IDYVRKHGEG  60
NWNAVQKHSG LSRCGKSCRL RWANHLRPNL KKGSFTAEEE QLIAQLHSEM GNRWARMAAH  120
LPGRTDNEIK NYWNTRTKRR SRAGLPLYPP DVSLRKMQGN QRGQGTGRID DGDRGHHDFL  180
PKNNYEIHDV IFDNLKENQG ILPIAIVPEN PDISANSILL NGLDSPPYCN SVPSSSLPNH  240
HHLRESTMSF LGSSGTNKNW FYPFYHVQDH SSDKIVQSFG LHSPLDPGLS SHNSMYYRHS  300
LSNGNSSTSK PTSKAVKLEL PSLQYPDTGF GGWGATFPPS PLNESVDVFN QSPLPHGGLE  360
SGSSSPHNSG TLEAIIYQKK TLPNSKNNYS DKSSHSSTAT PVDRAESSAL NMNETEWEDY  420
NDHASPFGAT SILNECPAVN SNANSWDKLT PSQNFSGNNV KYEPVDQVYT PSSENPLSML  480
NITWPDVLLA SDWHEQCYGH EKNMTDARDN LTDYKKHVAG GSYSSSTGGY FMHMA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-3171406127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458881.10.0myb transcription factor
TrEMBLA0A072UV520.0A0A072UV52_MEDTR; Myb transcription factor
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.19e-99myb domain protein 65